Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP31976_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31976_P050-FITC Conjugated

ARP31976_P050-HRP Conjugated

ARP31976_P050-Biotin Conjugated

TFAP2E Antibody - N-terminal region (ARP31976_P050)

Catalog#: ARP31976_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Human, Mouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-131391 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2E
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 92%
Complete computational species homology dataAnti-TFAP2E (ARP31976_P050)
Peptide SequenceSynthetic peptide located within the following region: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-TFAP2E (ARP31976_P050) antibody is Catalog # AAP31976 (Previous Catalog # AAPP02873)
Datasheets/ManualsPrintable datasheet for anti-TFAP2E (ARP31976_P050) antibody
Target ReferenceTummala,R., Gene 321, 93-102 (2003)
Gene SymbolTFAP2E
Official Gene Full NameTranscription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
Alias SymbolsAP2E, MGC49007
NCBI Gene Id339488
Protein NameTranscription factor AP-2-epsilon
Description of TargetTFAP2E is the sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 epsilon may play a role in the development of the CNS and in cartilage differentiation
Swissprot IdQ6VUC0
Protein Accession #NP_848643
Nucleotide Accession #NM_178548
Protein Size (# AA)442
Molecular Weight46kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TFAP2E.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TFAP2E.
Protein InteractionsUBC;
Write Your Own Review
You're reviewing:TFAP2E Antibody - N-terminal region (ARP31976_P050)
Your Rating
Aviva Tissue Tool
Free Microscope
Aviva Blast Tool
Aviva Travel Grant