Search Antibody, Protein, and ELISA Kit Solutions

TFAP2E Antibody - N-terminal region (ARP31976_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31976_P050-FITC Conjugated

ARP31976_P050-HRP Conjugated

ARP31976_P050-Biotin Conjugated

Gene Symbol:
TFAP2E
Official Gene Full Name:
Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
NCBI Gene Id:
339488
Protein Name:
Transcription factor AP-2-epsilon
Swissprot Id:
Q6VUC0
Protein Accession #:
NP_848643
Nucleotide Accession #:
NM_178548
Alias Symbols:
AP2E, MGC49007
Replacement Item:
This antibody may replace item sc-131391 from Santa Cruz Biotechnology.
Description of Target:
TFAP2E is the sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 epsilon may play a role in the development of the CNS and in cartilage differentiation
Protein Size (# AA):
442
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TFAP2E.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TFAP2E.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2E
Predicted Species Reactivity:
Cow, Human, Mouse
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 92%
Complete computational species homology data:
Anti-TFAP2E (ARP31976_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-TFAP2E (ARP31976_P050) antibody is Catalog # AAP31976 (Previous Catalog # AAPP02873)
Datasheets/Manuals:
Printable datasheet for anti-TFAP2E (ARP31976_P050) antibody
Target Reference:
Tummala,R., Gene 321, 93-102 (2003)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...