SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57907_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP57907_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-TFAP2B (ARP57907_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP
Concentration0.5 mg/ml
Blocking PeptideFor anti-TFAP2B (ARP57907_P050-HRP) antibody is Catalog # AAP57907 (Previous Catalog # AAPP32318)
ReferenceHensch,T., (2008) Neurosci. Lett. 436 (1), 67-71
Gene SymbolTFAP2B
Gene Full NameTranscription factor AP-2 beta (activating enhancer binding protein 2 beta)
Alias SymbolsPDA2, AP-2B, AP2-B, AP-2beta
NCBI Gene Id7021
Protein NameTranscription factor AP-2-beta
Description of TargetTFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c
Uniprot IDQ92481
Protein Accession #NP_003212
Nucleotide Accession #NM_003221
Protein Size (# AA)460
Molecular Weight50kDa
Protein InteractionsYEATS4; UBC; KCTD1; UBE2I; SUMO1; SSBP4; LZTR1; VPS11; HIST1H2AC; CITED4; MYC; CITED2; CITED1;
  1. What is the species homology for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    This target may also be called "PDA2, AP-2B, AP2-B, AP-2beta" in publications.

  5. What is the shipping cost for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFAP2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFAP2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFAP2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFAP2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFAP2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFAP2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFAP2B Antibody - N-terminal region : HRP (ARP57907_P050-HRP)
Your Rating
We found other products you might like!