- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-TFAP2B (ARP38283_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2B |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 82%; Zebrafish: 85% |
Peptide Sequence | Synthetic peptide located within the following region: ALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TFAP2B (ARP38283_P050) antibody is Catalog # AAP38283 (Previous Catalog # AAPP23122) |
Reference | Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71 |
Gene Symbol | TFAP2B |
---|---|
Gene Full Name | Transcription factor AP-2 beta (activating enhancer binding protein 2 beta) |
Alias Symbols | PDA2, AP-2B, AP2-B, AP-2beta |
NCBI Gene Id | 7021 |
Protein Name | Transcription factor AP-2-beta |
Description of Target | TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes.This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c |
Uniprot ID | Q92481 |
Protein Accession # | NP_003212 |
Nucleotide Accession # | NM_003221 |
Protein Size (# AA) | 460 |
Molecular Weight | 50kDa |
Protein Interactions | YEATS4; UBC; KCTD1; UBE2I; SUMO1; SSBP4; LZTR1; VPS11; HIST1H2AC; CITED4; MYC; CITED2; CITED1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TFAP2B Antibody - C-terminal region (ARP38283_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
This target may also be called "PDA2, AP-2B, AP2-B, AP-2beta" in publications.
-
What is the shipping cost for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "50kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TFAP2B Antibody - C-terminal region (ARP38283_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TFAP2B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TFAP2B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TFAP2B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TFAP2B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TFAP2B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TFAP2B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.