ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: P100878_T100
Price: $0.00
SKU
P100878_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TFAP2A (P100878_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS
Concentration1.0 mg/ml
Blocking PeptideFor anti-TFAP2A (P100878_T100) antibody is Catalog # AAP31161 (Previous Catalog # AAPP01904)
ReferenceLi,M., et al., (2006) Int. J. Cancer 118 (4), 802-811
Publications

Anti-TFAP2A P100878_T100 has recently been referenced in the following publications:

Li, J. et al. A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells. FEBS Lett. 584, 3198-202 (2010). 20547158

Gene SymbolTFAP2A
Gene Full NameTranscription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Alias SymbolsAP-2, BOFS, AP2TF, TFAP2, AP-2alpha
NCBI Gene Id7020
Protein NameTranscription factor AP-2-alpha
Description of TargetTFAP2A is a sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limbs and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 alpha is the only AP-2 protein required for early morphogenesis of the lens vesicleAP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM].
Uniprot IDP05549
Protein Accession #NP_003211
Nucleotide Accession #NM_003220
Protein Size (# AA)437
Molecular Weight48kDa
Protein InteractionsMKRN3; GSTO2; KCTD15; SUMO1; HECW2; SP1; BAG3; RB1; UBC; DAB2; Fcho2; EPAS1; SRA1; EPS15; KCTD1; EPN1; SH3BP4; UBE2I; AURKA; BRCA1; DNMT3A; ELAVL1; SUMO4; SUMO2; NPM1; YY1; PPARG; EPN2; CITED4; LDLRAP1; CITED2; EP300; MAGI1; WWP2; WWP1; HIP1; CASP6; CASP3
  1. What is the species homology for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFAP2A Antibody - C-terminal region (P100878_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    This target may also be called "AP-2, BOFS, AP2TF, TFAP2, AP-2alpha" in publications.

  5. What is the shipping cost for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFAP2A Antibody - C-terminal region (P100878_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFAP2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFAP2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFAP2A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFAP2A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFAP2A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFAP2A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFAP2A Antibody - C-terminal region (P100878_T100)
Your Rating
We found other products you might like!