Catalog No: ARP31400_P050 (Formerly GWB-22C6C2)
Price: $0.00
SKU
ARP31400_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
View product citations for antibody ARP31400_P050 on CiteAb
Datasheets/ManualsPrintable datasheet for anti-TFAM (ARP31400_P050) antibody
Product Info
Publications

Marcia A Ogasawara, Jinyun Liu, Helene Pelicano, Naima Hammoudi, Carlo M Croce, Michael J Keating, Peng Huang. Alterations of mitochondrial biogenesis in chronic lymphocytic leukemia cells with loss of p53.. Mitochondrion. 31, 33-39 (2016). WB 27650502

Matteo Audano, Silvia Pedretti, Gaia Cermenati, Elisabetta Brioschi, Giuseppe Riccardo Diaferia, Serena Ghisletti, Alessandro Cuomo, Tiziana Bonaldi, Franco Salerno, Marina Mora, Liliana Grigore, Katia Garlaschelli, Andrea Baragetti, Fabrizia Bonacina, Alberico Luigi Catapano, Giuseppe Danilo Norata, Maurizio Crestani, Donatella Caruso, Enrique Saez, Emma De Fabiani, Nico Mitro. Zc3h10 is a novel mitochondrial regulator.. EMBO Rep. 19, (2018). WB 29507079

Shuta Nagata, Kaoru Tatematsu, Kazuki Kansaku, Yuki Inoue, Mitsuru Kobayashi, Koumei Shirasuna, Hisataka Iwata. Effect of aging on mitochondria and metabolism of bovine granulosa cells.. J Reprod Dev. 66, 547-554 (2020). WB 32921645

More...

Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 83%; Guinea Pig: 75%; Horse: 92%; Human: 100%; Mouse: 75%; Pig: 92%; Rabbit: 83%
Peptide SequenceSynthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TFAM (ARP31400_P050) antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
ReferenceCruzen,M.E., Gene 362, 125-132 (2005)
Gene SymbolTFAM
Gene Full NameTranscription factor A, mitochondrial
Alias SymbolsTCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
NCBI Gene Id7019
Protein NameTranscription factor A, mitochondrial
Description of TargetThe function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Uniprot IDQ00059
Protein Accession #NP_003192
Nucleotide Accession #NM_003201
Protein Size (# AA)246
Molecular Weight29kDa
Protein InteractionsAGTRAP; FBXW11; ARL6IP1; NEDD1; PPP2R1A; GRSF1; UBC; MDM2; SUZ12; EED; PAN2; MYC; FN1; C1QBP; CAND1; COPS5; CUL3; ELAVL1; ICT1; TFB2M; TFB1M; PNP; NRF1;
  1. What is the species homology for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TFAM Antibody - N-terminal region (ARP31400_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    This target may also be called "TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15" in publications.

  5. What is the shipping cost for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TFAM Antibody - N-terminal region (ARP31400_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFAM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFAM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFAM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFAM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TFAM Antibody - N-terminal region (ARP31400_P050)
Your Rating
We found other products you might like!