Loading...
Catalog No: ARP58723_P050
Price: $0.00
SKU
ARP58723_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Tfam (ARP58723_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%
Peptide SequenceSynthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
Concentration0.5 mg/ml
Blocking PeptideFor anti-Tfam (ARP58723_P050) antibody is Catalog # AAP58723 (Previous Catalog # AAPP36030)
Gene SymbolTfam
Gene Full NameTranscription factor A, mitochondrial
Alias SymbolsHmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103
NCBI Gene Id21780
Protein NameTranscription factor A, mitochondrial
Description of TargetThe function remains unknown.
Uniprot IDP40630
Protein Accession #NP_033386
Nucleotide Accession #NM_009360
Protein Size (# AA)243
Molecular Weight28kDa
Protein InteractionsC1QBP; SNCA;
  1. What is the species homology for "Tfam Antibody - middle region (ARP58723_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "Tfam Antibody - middle region (ARP58723_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Tfam Antibody - middle region (ARP58723_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Tfam Antibody - middle region (ARP58723_P050)"?

    This target may also be called "Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103" in publications.

  5. What is the shipping cost for "Tfam Antibody - middle region (ARP58723_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Tfam Antibody - middle region (ARP58723_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Tfam Antibody - middle region (ARP58723_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Tfam Antibody - middle region (ARP58723_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TFAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TFAM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TFAM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TFAM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TFAM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Tfam Antibody - middle region (ARP58723_P050)
Your Rating
We found other products you might like!