Catalog No: ARP53844_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TEX14 (ARP53844_P050) antibody
Product Info
ReferenceWu,M.H., (2003) Gene Expr. Patterns 3 (2), 231-236
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TEX14
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 86%; Human: 100%; Rabbit: 86%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN
Concentration0.5 mg/ml
Blocking PeptideFor anti-TEX14 (ARP53844_P050) antibody is Catalog # AAP53844 (Previous Catalog # AAPP30683)
Gene SymbolTEX14
Gene Full NameTestis expressed 14
Alias SymbolsCT113, SPGF23
NCBI Gene Id56155
Protein NameInactive serine/threonine-protein kinase TEX14
Description of TargetTEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.
Uniprot IDQ8IWB6
Protein Accession #NP_112562
Nucleotide Accession #NM_031272
Protein Size (# AA)1451
Molecular Weight160kDa
Protein InteractionsTEX14; CEP55;
  1. What is the species homology for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Horse, Rabbit".

  2. How long will it take to receive "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TEX14 Antibody - C-terminal region (ARP53844_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    This target may also be called "CT113, SPGF23" in publications.

  5. What is the shipping cost for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "160kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TEX14 Antibody - C-terminal region (ARP53844_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TEX14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TEX14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TEX14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TEX14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TEX14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TEX14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TEX14 Antibody - C-terminal region (ARP53844_P050)
Your Rating