Catalog No: ARP53623_P050
Price: $0.00
SKU
ARP53623_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TESMIN (ARP53623_P050) antibody
Product Info
ReferenceOh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MTL5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 83%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGI
Concentration0.5 mg/ml
Blocking PeptideFor anti-TESMIN (ARP53623_P050) antibody is Catalog # AAP53623 (Previous Catalog # AAPP30463)
Gene SymbolTESMIN
Gene Full Nametestis expressed metallothionein like protein
Alias SymbolsMTL5, MTLT, CXCDC2
NCBI Gene Id9633
Protein Nametesmin
Description of TargetMetallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9Y4I5
Protein Accession #NP_004914
Nucleotide Accession #NM_004923
Protein Size (# AA)508
Molecular Weight56kDa
  1. What is the species homology for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog".

  2. How long will it take to receive "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TESMIN Antibody - N-terminal region (ARP53623_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    This target may also be called "MTL5, MTLT, CXCDC2" in publications.

  5. What is the shipping cost for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TESMIN Antibody - N-terminal region (ARP53623_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TESMIN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TESMIN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TESMIN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TESMIN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TESMIN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TESMIN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TESMIN Antibody - N-terminal region (ARP53623_P050)
Your Rating