TES-26 Recombinant Protein (Canine roundworm) (OPCA02090)

Catalog No: OPCA02090

TES-26 Recombinant Protein (Toxocara canis) (OPCA02090) in SDS-PAGE showing the molecular weight of approximately 41.9 kDa.

Product Info

• Predicted Species Reactivity: Toxocara canis
• Product Format: Liquid or Lyophilized powder
• Host: Toxocara canis
• Additional Information: Relevance: Binds phosphatidylethanolamine.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
• Protein Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 22-262 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995)
• Gene Symbol: TES-26
• Alias Symbols: Toxocara excretory-secretory antigen 26.
• Protein Name: 26 kDa secreted antigen
• Description of Target: Binds phosphatidylethanolamine.
• Uniprot ID: P54190
• Protein Size (# AA): Recombinant
• Molecular Weight: 41.9 kDa