Catalog No: ARP53082_P050
Price: $0.00
SKU
ARP53082_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TENT5D Antibody - middle region (ARP53082_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TENT5D (ARP53082_P050) antibody
Product Info
ReferenceRoss,M.T., (2005) Nature 434 (7031), 325-337
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FAM46D
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Peptide SequenceSynthetic peptide located within the following region: LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM
Concentration0.5 mg/ml
Blocking PeptideFor anti-TENT5D (ARP53082_P050) antibody is Catalog # AAP53082 (Previous Catalog # AAPP35312)
Gene SymbolTENT5D
Gene Full Nameterminal nucleotidyltransferase 5D
Alias SymbolsCT112, CT1.26, FAM46D
NCBI Gene Id169966
Protein Nameterminal nucleotidyltransferase 5D; putative nucleotidyltransferase FAM46D
Description of TargetAntibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown.
Uniprot IDQ8NEK8
Protein Accession #NP_689843
Nucleotide Accession #NM_152630
Protein Size (# AA)389
Molecular Weight44kDa
Protein InteractionsC1orf94; RHOXF2;
  1. What is the species homology for "TENT5D Antibody - middle region (ARP53082_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Pig".

  2. How long will it take to receive "TENT5D Antibody - middle region (ARP53082_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TENT5D Antibody - middle region (ARP53082_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TENT5D Antibody - middle region (ARP53082_P050)"?

    This target may also be called "CT112, CT1.26, FAM46D" in publications.

  5. What is the shipping cost for "TENT5D Antibody - middle region (ARP53082_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TENT5D Antibody - middle region (ARP53082_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TENT5D Antibody - middle region (ARP53082_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TENT5D Antibody - middle region (ARP53082_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TENT5D"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TENT5D"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TENT5D"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TENT5D"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TENT5D"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TENT5D"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TENT5D Antibody - middle region (ARP53082_P050)
Your Rating