TEN1 Antibody - N-terminal region (ARP90551_P050)

Catalog No: ARP90551_P050

Host: Rabbit
Target Name: TEN1
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of Mouse TEN1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TEN1 (ARP90551_P050) antibody is Catalog # AAP90551

Target Info

• Gene Symbol: TEN1
• Gene Full Name: TEN1 telomerase capping complex subunit
• Alias Symbols: 2310004N24Rik
• NCBI Gene Id: 69535
• Protein Name: CST complex subunit TEN1
• Description of Target: Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation. However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha. The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins (By similarity).
• Uniprot ID: Q9D7K2
• Protein Accession #: NP_081383.1
• Nucleotide Accession #: NM_027107.1
• Protein Size (# AA): 161
• Molecular Weight: 18 kDa