Search Antibody, Protein, and ELISA Kit Solutions

TECPR1 Antibody - N-terminal region : FITC (ARP71734_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP71734_P050 Unconjugated

ARP71734_P050-HRP Conjugated

ARP71734_P050-Biotin Conjugated

Gene Symbol:
TECPR1
NCBI Gene Id:
25851
Swissprot Id:
Q7Z6L1-3
Protein Accession #:
XP_005250311
Alias Symbols:
TECPR1, KIAA1358,
Replacement Item:
This antibody may replace item sc-240971 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a tethering factor involved in autophagy. The encoded protein is found at autolysosomes, and is involved in targeting protein aggregates, damaged mitochondria, and bacterial pathogens for autophagy.
Protein Size (# AA):
776
Molecular Weight:
85kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TECPR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TECPR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TECPR1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: YTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPSKDDPKELPDPFNDLSVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
ATG5; ATG12; COL18A1; MCMBP; ATG3; TRAPPC11; TRAPPC12; TRAPPC8; PLOD3;
Blocking Peptide:
For anti-TECPR1 (ARP71734_P050-FITC) antibody is Catalog # AAP71734
Datasheets/Manuals:
Printable datasheet for anti-TECPR1 (ARP71734_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...