TEC Antibody - middle region (ARP51209_P050)

Catalog No: ARP51209_P050

WB Suggested Anti-TEC Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEC
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TEC (ARP51209_P050) antibody is Catalog # AAP51209 (Previous Catalog # AAPP28077)

Target Info

• Gene Symbol: TEC
• Gene Full Name: Tec protein tyrosine kinase
• Alias Symbols: PSCTK4
• NCBI Gene Id: 7006
• Protein Name: Tyrosine-protein kinase Tec
• Description of Target: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.
• Uniprot ID: P42680
• Protein Accession #: NP_003206
• Nucleotide Accession #: NM_003215
• Protein Size (# AA): 631
• Molecular Weight: 73kDa
• Protein Interactions: ERBB2; MED28; GRB2; SHC1; FASLG; Nedd4; UBC; IKBKG; STAP1; PIP4K2A; PLK4; PTPN18; PIK3R3; GNA12; SOCS1; PIP5K1A; PTPN21; DOK1; TEC; PLCG2; WAS; BTK; BMX; TP53; PRLR; PLCG1; PIK3R1; LYN; KIT; VAV1; JAK2; JAK1; ARHGEF12; GNA13; RHOA; RAC1; PIK3R2;