Catalog No: ARP33426_P050
Price: $0.00
SKU
ARP33426_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TEAD4 (ARP33426_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TEAD4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-TEAD4 (ARP33426_P050) antibody is Catalog # AAP33426 (Previous Catalog # AAPP04472)
ReferenceAppukuttan,B., (2007) Invest. Ophthalmol. Vis. Sci. 48 (8), 3775-3782
Publications

Chan, S. W. et al. TEADs mediate nuclear retention of TAZ to promote oncogenic transformation. J. Biol. Chem. 284, 14347-58 (2009). 19324876

YAP1 Exerts Its Transcriptional Control via TEAD-Mediated Activation of Enhancers. PLoS Genet. 11, e1005465 (2015). 26295846

Description
Gene SymbolTEAD4
Gene Full NameTEA domain family member 4
Alias SymbolsTEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B
NCBI Gene Id7004
Protein NameTranscriptional enhancer factor TEF-3
Description of TargetTEAD4 is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this protein.This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.
Uniprot IDQ15561
Protein Accession #NP_958849
Nucleotide Accession #NM_201441
Protein Size (# AA)391
Molecular Weight44kDa
Protein InteractionsCCDC172; SSX2IP; LZTS2; CEP70; CEP55; RABGEF1; CCNDBP1; KIAA0753; PNMA1; TRAF1; VPS52; TRIM27; GOLGA2; UBC; SUMO2; CCDC85B; WWTR1; YAP1; VGLL1; MYH7;
  1. What is the species homology for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TEAD4 Antibody - middle region (ARP33426_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TEAD4 Antibody - middle region (ARP33426_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    This target may also be called "TEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B" in publications.

  5. What is the shipping cost for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TEAD4 Antibody - middle region (ARP33426_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TEAD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TEAD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TEAD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TEAD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TEAD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TEAD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TEAD4 Antibody - middle region (ARP33426_P050)
Your Rating
We found other products you might like!