- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-TEAD1 (OAAN02002) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IF, CHIP |
Additional Information | Positive Samples: HeLa, MCF-7, mouse kidney, mouse heart, rat kidney, rat heart Cellular Location: Nucleus |
Reconstitution and Storage | Store at -20°C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). |
Purification | Affinity purified against immunogen |
Peptide Sequence | AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK |
Application Info | WB: 1:500~2000 IF/ICC: 1:50~200 CHIP: 1:50~200 |
Gene Symbol | TEAD1 |
---|---|
Gene Full Name | TEA domain transcription factor 1 |
Alias Symbols | AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1 |
NCBI Gene Id | 7003 |
Protein Name | Transcriptional enhancer factor TEF-1 |
Description of Target | This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified. |
Uniprot ID | P28347 |
Protein Accession # | NP_068780.2 |
Nucleotide Accession # | NM_021961.5 |
Molecular Weight | 48 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TEAD1 Antibody (OAAN02002)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "TEAD1 Antibody (OAAN02002)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "TEAD1 Antibody (OAAN02002)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TEAD1 Antibody (OAAN02002)"?
This target may also be called "AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1" in publications.
-
What is the shipping cost for "TEAD1 Antibody (OAAN02002)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TEAD1 Antibody (OAAN02002)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TEAD1 Antibody (OAAN02002)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TEAD1 Antibody (OAAN02002)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TEAD1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TEAD1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TEAD1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TEAD1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TEAD1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TEAD1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.