TDRKH Antibody - middle region (ARP83125_P050)

Catalog No: ARP83125_P050

Host: Rabbit
Target Name: TDRKH
Sample Tissue: Human Du145 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TDRKH
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TDRKH (ARP83125_P050) antibody is Catalog # AAP83125

Target Info

• Gene Symbol: TDRKH
• Gene Full Name: tudor and KH domain containing
• Alias Symbols: TDRD2
• NCBI Gene Id: 11022
• Protein Name: tudor and KH domain-containing protein
• Description of Target: Participates in the primary piRNA biogenesis pathway and is required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for the germline integrity. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Required for the final steps of primary piRNA biogenesis by participating in the processing of 31-37 nt intermediates into mature piRNAs. May act in pi-bodies and piP-bodies by transferring piRNA precursors or intermediates to or between these granules.
• Uniprot ID: Q9Y2W6
• Protein Accession #: NP_001077432.1
• Nucleotide Accession #: NM_001083963.1
• Protein Size (# AA): 561
• Molecular Weight: 61 kDa