TCTN3 Antibody - middle region (ARP44677_P050)

Catalog No: ARP44677_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateTCTN3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Host: Rabbit
Target Name: TCTN3
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Rabbit Anti-TCTN3 Antibody
Catalog Number: ARP44677_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Plasma membrane and cytoplasm in hepatocytes
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCTN3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TCTN3 (ARP44677_P050) antibody is Catalog # AAP44677 (Previous Catalog # AAPP12149)
• Sample Type Confirmation:

  TCTN3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Reiter,J.F. (2006) Genes Dev. 20 (1), 22-27

Target Info

• Gene Symbol: TCTN3
• Gene Full Name: Tectonic family member 3
• Alias Symbols: OFD4, TECT3, JBTS18, C10orf61
• NCBI Gene Id: 26123
• Protein Name: Tectonic-3
• Description of Target: TCTN3 may be involved in apoptosis regulation.
• Uniprot ID: Q6NUS6
• Protein Accession #: NP_056446
• Nucleotide Accession #: NM_015631
• Protein Size (# AA): 607
• Molecular Weight: 64kDa
• Protein Interactions: FBXO6;