Search Antibody, Protein, and ELISA Kit Solutions

TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75152_P050 Unconjugated

ARP75152_P050-HRP Conjugated

ARP75152_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TCOF1
Official Gene Full Name:
treacle ribosome biogenesis factor 1
NCBI Gene Id:
6949
Protein Name:
treacle protein
Swissprot Id:
Q13428-2
Alias Symbols:
TCS, MFD1, TCS1, treacle
Description of Target:
This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
1411
Molecular Weight:
155kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TCOF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TCOF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCOF
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-TCOF1 (ARP75152_P050-FITC) antibody is Catalog # AAP75152
Datasheets/Manuals:
Printable datasheet for anti-TCOF1 (ARP75152_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...