Size:100 ul
$289.00
In Stock
SKU
ARP75152_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75152_P050 Unconjugated

ARP75152_P050-HRP Conjugated

ARP75152_P050-Biotin Conjugated

TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)

Catalog#: ARP75152_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCOF
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIY
Concentration 0.5 mg/ml
Blocking Peptide For anti-TCOF1 (ARP75152_P050-FITC) antibody is Catalog # AAP75152
Datasheets/Manuals Printable datasheet for anti-TCOF1 (ARP75152_P050-FITC) antibody
Target Reference N/A
Gene Symbol TCOF1
Official Gene Full Name treacle ribosome biogenesis factor 1
Alias Symbols TCS, MFD1, TCS1, treacle
NCBI Gene Id 6949
Protein Name treacle protein
Description of Target This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q13428-2
Protein Size (# AA) 1411
Molecular Weight 155kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TCOF1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TCOF1.
  1. What is the species homology for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    This target may also be called "TCS, MFD1, TCS1, treacle" in publications.

  5. What is the shipping cost for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "155kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TCOF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TCOF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TCOF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TCOF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TCOF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TCOF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TCOF1 Antibody - N-terminal region : FITC (ARP75152_P050-FITC)
Your Rating
We found other products you might like!