Search Antibody, Protein, and ELISA Kit Solutions

Tcfap4 Antibody - middle region (ARP37415_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP37415_P050-FITC Conjugated

ARP37415_P050-HRP Conjugated

ARP37415_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Tfap4
Official Gene Full Name:
Transcription factor AP4
NCBI Gene Id:
83383
Protein Name:
Activator protein 4 EMBL AAF80448.1
Swissprot Id:
Q9JIZ5
Protein Accession #:
NP_112459
Nucleotide Accession #:
NM_031182
Alias Symbols:
AI642933, AP-4, D930048N17Rik, Tfap4, Tcfap4, bHLHc41
Replacement Item:
This antibody may replace item sc-166024 from Santa Cruz Biotechnology.
Description of Target:
TCFap4 belongs to the basic helix-loop-helix (bHLH) family, and is involved in various cell differentiation processes.
Protein Size (# AA):
338
Molecular Weight:
39kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Tcfap4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Tcfap4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Tcfap4 (ARP37415_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TCF3;
Blocking Peptide:
For anti-Tfap4 (ARP37415_P050) antibody is Catalog # AAP37415 (Previous Catalog # AAPP09286)
Datasheets/Manuals:
Printable datasheet for anti-Tfap4 (ARP37415_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...