TCF7 Antibody - C-terminal region : HRP (P100890_P050-HRP)

Catalog No: P100890_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TCF7
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Human: 100%; Mouse: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAER
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TCF7 (P100890_P050-HRP) antibody is Catalog # AAP31237 (Previous Catalog # AAPP01982)
• Sample Type Confirmation:

  TCF7 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Info

• Reference: Roose J., et al., (1999) Science 285:1923-1926
• Gene Symbol: TCF7
• Gene Full Name: Transcription factor 7 (T-cell specific, HMG-box)
• Alias Symbols: TCF-1
• NCBI Gene Id: 6932
• Protein Name: Transcription factor 7
• Description of Target: The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
• Uniprot ID: P36402-3
• Protein Size (# AA): 494
• Molecular Weight: 54kDa
• Protein Interactions: UBC; SS18L1; DAZAP2;