Search Antibody, Protein, and ELISA Kit Solutions

TCF4 Antibody - middle region (ARP89031_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse TCF4
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TCF4 (ARP89031_P050) antibody is Catalog # AAP89031
Datasheets/Manuals:
Printable datasheet for anti-TCF4 (ARP89031_P050) antibody
Gene Symbol:
TCF4
Official Gene Full Name:
transcription factor 4
Alias Symbols:
ME2, TFE, E2-2, E2.2, ITF2, SEF2, ITF-2, SEF-2, Tcf-4, ASP-I2, ITF-2b, SEF2-1, MITF-2A, MITF-2B, bHLHb19, 5730422P05Rik
NCBI Gene Id:
21413
Protein Name:
transcription factor 4
Description of Target:
Transcription factor that binds to the immunoglobulin enhancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Isoform 2 inhibits MYOD1 activation of the cardiac alpha-actin promoter. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription. May have a regulatory function in developmental processes as well as during neuronal plasticity.
Swissprot Id:
Q60722-2
Protein Accession #:
NP_001077436.1
Nucleotide Accession #:
NM_001083967.1
Protein Size (# AA):
511
Molecular Weight:
56 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TCF4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TCF4.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...