Catalog No: ARP50833_P050
Price: $0.00
SKU
ARP50833_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Tcf23 (ARP50833_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP
Concentration0.5 mg/ml
Blocking PeptideFor anti-Tcf23 (ARP50833_P050) antibody is Catalog # AAP50833
Gene SymbolTcf23
Gene Full NameTranscription factor 23
Alias SymbolsOu, Out, bHLHa, bHLHa24, 2010002O16Rik
NCBI Gene Id69852
Protein NameTranscription factor 23
Description of TargetTcf23 inhibits E-box-mediated binding and transactivation of bHLH factors. Inhibitory effect is similar to that of ID proteins. Tcf23 inhibits the formation of TCF3 and MYOD1 homo- and heterodimers. Tcf23 lacks DNA binding activity. Tcf23 may be involved in the regulation or modulation of smooth muscle contraction of the uterus during pregnancy and particularly around the time of delivery. Tcf23 seems to play a role in the inhibition of myogenesis.
Uniprot IDQ9JLR5
Protein Accession #NP_444315
Nucleotide Accession #NM_053085
Protein Size (# AA)209
Molecular Weight23kDa
  1. What is the species homology for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "Tcf23 Antibody - middle region (ARP50833_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Tcf23 Antibody - middle region (ARP50833_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    This target may also be called "Ou, Out, bHLHa, bHLHa24, 2010002O16Rik" in publications.

  5. What is the shipping cost for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Tcf23 Antibody - middle region (ARP50833_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TCF23"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TCF23"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TCF23"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TCF23"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TCF23"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TCF23"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Tcf23 Antibody - middle region (ARP50833_P050)
Your Rating
We found other products you might like!