ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: P100771_P050
Price: $0.00
SKU
P100771_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TCF12 (P100771_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Cow, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TCF12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TCF12 (P100771_P050) antibody is Catalog # AAP31099 (Previous Catalog # AAPS32601)
ReferenceZhang,J., et al., (2004) Science 305 (5688), 1286-1289
Gene SymbolTCF12
Gene Full NameTranscription factor 12
Alias SymbolsHEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
NCBI Gene Id6938
Protein NameTranscription factor 12
Description of TargetTCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins.The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Uniprot IDQ99081
Protein Accession #NP_996919
Nucleotide Accession #NM_207036
Protein Size (# AA)706
Molecular Weight73kDa
Protein InteractionsTSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;
  1. What is the species homology for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Cow, Pig, Zebrafish".

  2. How long will it take to receive "TCF12 Antibody - N-terminal region (P100771_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TCF12 Antibody - N-terminal region (P100771_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    This target may also be called "HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266" in publications.

  5. What is the shipping cost for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TCF12 Antibody - N-terminal region (P100771_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TCF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TCF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TCF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TCF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TCF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TCF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TCF12 Antibody - N-terminal region (P100771_P050)
Your Rating
We found other products you might like!