Catalog No: P100772_P050-HRP
Size:100ul
Price: $434.00
SKU
P100772_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TCF12 Antibody - middle region : HRP (P100772_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-TCF12 (P100772_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TCF12
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TCF12 (P100772_P050-HRP) antibody is Catalog # AAP31100 (Previous Catalog # AAPP01839)
ReferenceWissmuller,S., (2006) (er) Nucleic Acids Res. 34 (6), 1735-1744
Gene SymbolTCF12
Gene Full NameTranscription factor 12
Alias SymbolsHEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
NCBI Gene Id6938
Protein NameTranscription factor 12
Description of TargetTCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cell. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Uniprot IDQ99081
Protein Accession #NP_003196
Nucleotide Accession #NM_003205
Protein Size (# AA)682
Molecular Weight73kDa
Protein InteractionsTSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;
  1. What is the species homology for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    This target may also be called "HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266" in publications.

  5. What is the shipping cost for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TCF12 Antibody - middle region : HRP (P100772_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TCF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TCF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TCF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TCF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TCF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TCF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TCF12 Antibody - middle region : HRP (P100772_P050-HRP)
Your Rating
We found other products you might like!