TCF12 Antibody - middle region : HRP (P100772_P050-HRP)

Catalog No: P100772_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCF12
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TCF12 (P100772_P050-HRP) antibody is Catalog # AAP31100 (Previous Catalog # AAPP01839)

Target Info

• Reference: Wissmuller,S., (2006) (er) Nucleic Acids Res. 34 (6), 1735-1744
• Gene Symbol: TCF12
• Gene Full Name: Transcription factor 12
• Alias Symbols: HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
• NCBI Gene Id: 6938
• Protein Name: Transcription factor 12
• Description of Target: TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cell. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Uniprot ID: Q99081
• Protein Accession #: NP_003196
• Nucleotide Accession #: NM_003205
• Protein Size (# AA): 682
• Molecular Weight: 73kDa
• Protein Interactions: TSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;