Search Antibody, Protein, and ELISA Kit Solutions

TBXAS1 Antibody - middle region (ARP82090_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TBXAS1
Official Gene Full Name:
thromboxane A synthase 1
NCBI Gene Id:
6916
Protein Name:
thromboxane-A synthase
Swissprot Id:
P24557-2
Protein Accession #:
NP_001052.2
Nucleotide Accession #:
NM_001061.4
Alias Symbols:
TS, TXS, CYP5, THAS, TXAS, CYP5A1, GHOSAL, BDPLT14
Description of Target:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
466
Molecular Weight:
51 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBXAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBXAS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TBXAS1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TBXAS1 (ARP82090_P050) antibody is Catalog # AAP82090
Datasheets/Manuals:
Printable datasheet for anti-TBXAS1 (ARP82090_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...