Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP82090_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

TBXAS1 Antibody - middle region (ARP82090_P050)

Catalog#: ARP82090_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TBXAS1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: DPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TBXAS1 (ARP82090_P050) antibody is Catalog # AAP82090
Datasheets/Manuals Printable datasheet for anti-TBXAS1 (ARP82090_P050) antibody
Gene Symbol TBXAS1
Official Gene Full Name thromboxane A synthase 1
Alias Symbols TS, TXS, CYP5, THAS, TXAS, CYP5A1, GHOSAL, BDPLT14
NCBI Gene Id 6916
Protein Name thromboxane-A synthase
Description of Target This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Swissprot Id P24557-2
Protein Accession # NP_001052.2
Nucleotide Accession # NM_001061.4
Protein Size (# AA) 466
Molecular Weight 51 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TBXAS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TBXAS1.
  1. What is the species homology for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "TBXAS1 Antibody - middle region (ARP82090_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    This target may also be called "TS, TXS, CYP5, THAS, TXAS, CYP5A1, GHOSAL, BDPLT14" in publications.

  5. What is the shipping cost for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TBXAS1 Antibody - middle region (ARP82090_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TBXAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TBXAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TBXAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TBXAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TBXAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TBXAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TBXAS1 Antibody - middle region (ARP82090_P050)
Your Rating
We found other products you might like!