TBX5 Antibody - N-terminal region (ARP33403_P050)

Catalog No: ARP33403_P050

Host: Rabbit
Target Name: TBX5
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 2ug/ml

Host: Rabbit
Target Name: TBX5
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 3ug/ml

Host: Rabbit
Target Name: TBX5
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 3ug/ml

Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0ug/ml using anti-TBX5 antibody (ARP33403_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TBX5 (ARP33403_P050) antibody is Catalog # AAP33403 (Previous Catalog # AAPP04449)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Zaragoza,M.V., et al., (2004) Gene 330, 38978
• Publications:

  Baban, A. et al. Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: functional characterization of a de novo TBX5 mutation. Am. J. Med. Genet. A 164A, 1419-24 (2014). 24664498

  Lu, J. et al. Induction of apoptosis and inhibition of cell growth by tbx5 knockdown contribute to dysmorphogenesis in Zebrafish embryos. J. Biomed. Sci. 18, 73 (2011). 21982178

  The Cardiac TBX5 Interactome Reveals a Chromatin Remodeling Network Essential for Cardiac Septation. Dev Cell. 36, 262-75 (2016). 26859351

  Zhang, Y., Huang, L., Zuo, Z., Chen, Y. & Wang, C. Phenanthrene exposure causes cardiac arrhythmia in embryonic zebrafish via perturbing calcium handling. Aquat. Toxicol. 142-143, 26-32 (2013). 23948075

• Description:
  View product citations for TBX5 Antibody - N-terminal region (ARP33403_P050) on CiteAb

Target Info

• Gene Symbol: TBX5
• Gene Full Name: T-box 5
• Alias Symbols: HOS
• NCBI Gene Id: 6910
• Protein Name: T-box transcription factor TBX5
• Description of Target: TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX5 is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in TBX5 have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for TBX5.
• Uniprot ID: Q99593
• Protein Accession #: NP_000183
• Nucleotide Accession #: NM_000192
• Protein Size (# AA): 518
• Molecular Weight: 58 kDa
• Protein Interactions: KDM6A; SMARCA4; KAT5; GATA4; NKX2-5;