Search Antibody, Protein, and ELISA Kit Solutions

TBX22 Antibody - middle region (ARP88660_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
T-box 22
NCBI Gene Id:
Protein Name:
T-box transcription factor TBX22
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
57 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX22.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX22.
The immunogen is a synthetic peptide directed towards the middle region of human TBX22
Peptide Sequence:
Synthetic peptide located within the following region: APLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TBX22 (ARP88660_P050) antibody is Catalog # AAP88660
Printable datasheet for anti-TBX22 (ARP88660_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...