TBX21 Antibody - C-terminal region (ARP37251_T100)

Catalog No: ARP37251_T100

WB Suggested Anti-TBX21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse TBX21
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TBX21 (ARP37251_T100) antibody is Catalog # AAP37251 (Previous Catalog # AAPP20136)
• Reference: Hirata,T., et al., (2006) Development 133 (8), 1433-1443

Target Info

• Gene Symbol: TBX21
• Gene Full Name: T-box 21
• Alias Symbols: TBT1, Tbet, Tbly, Tblym
• NCBI Gene Id: 57765
• Protein Name: T-box transcription factor TBX21
• Description of Target: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
• Uniprot ID: Q9JKD8
• Protein Accession #: NP_062380
• Nucleotide Accession #: NM_019507
• Protein Size (# AA): 530
• Molecular Weight: 58kDa
• Protein Interactions: Bcl6; Smarca4; Tlx3; Tead4; Pax9; Gsc; Gata3; Dlx1; Alx4; Rbpj; Stat1; Ifng; Tec; Itk; Txk;