Protein on Demand™ TBX19 Recombinant Protein (Human) (OPCA34448)

Datasheets/Manuals	Printable datasheet for OPCA34448

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-448

Gene Full Name	T-box 19
Alias Symbols	TPIT, TBS19, dJ747L4.1
NCBI Gene Id	9095
Protein Name	T-box transcription factor TBX19
Description of Target	This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in p
Uniprot ID	O60806
Protein Accession #	NP_005140.1
Nucleotide Accession #	NM_005149.2
Protein Size (# AA)	448