Search Antibody, Protein, and ELISA Kit Solutions

TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32363_T100 Unconjugated

ARP32363_T100-HRP Conjugated

ARP32363_T100-Biotin Conjugated

Gene Symbol:
TBX19
Official Gene Full Name:
T-box 19
NCBI Gene Id:
9095
Protein Name:
T-box transcription factor TBX19
Swissprot Id:
O60806
Protein Accession #:
NP_005140
Nucleotide Accession #:
NM_005149
Alias Symbols:
TPIT, TBS19, dJ747L4.1
Replacement Item:
This antibody may replace item sc-134060 from Santa Cruz Biotechnology.
Description of Target:
TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
Protein Size (# AA):
448
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX19.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TBX19 (ARP32363_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
NR5A1;
Blocking Peptide:
For anti-TBX19 (ARP32363_T100-FITC) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
Datasheets/Manuals:
Printable datasheet for anti-TBX19 (ARP32363_T100-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...