Size:100 ul
$249.00
In Stock
SKU
ARP32363_T100-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32363_T100 Unconjugated

ARP32363_T100-HRP Conjugated

ARP32363_T100-Biotin Conjugated

TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)

Catalog#: ARP32363_T100-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-134060 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-TBX19 (ARP32363_T100)
Peptide Sequence Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
Concentration 0.5 mg/ml
Blocking Peptide For anti-TBX19 (ARP32363_T100-FITC) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
Datasheets/Manuals Printable datasheet for anti-TBX19 (ARP32363_T100-FITC) antibody
Target Reference Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532
Gene Symbol TBX19
Official Gene Full Name T-box 19
Alias Symbols TPIT, TBS19, dJ747L4.1
NCBI Gene Id 9095
Protein Name T-box transcription factor TBX19
Description of Target TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
Swissprot Id O60806
Protein Accession # NP_005140
Nucleotide Accession # NM_005149
Protein Size (# AA) 448
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TBX19.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TBX19.
Protein Interactions NR5A1;
  1. What is the species homology for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    This target may also be called "TPIT, TBS19, dJ747L4.1" in publications.

  5. What is the shipping cost for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TBX19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TBX19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TBX19"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TBX19"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TBX19"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TBX19"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TBX19 Antibody - N-terminal region : FITC (ARP32363_T100-FITC)
Your Rating
We found other products you might like!