Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TBX19 antibody - N-terminal region (ARP32363_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP32363_T100-FITC Conjugated

ARP32363_T100-HRP Conjugated

ARP32363_T100-Biotin Conjugated

Gene Symbol:
TBX19
NCBI Gene Id:
9095
Official Gene Full Name:
T-box 19
Protein Name:
T-box transcription factor TBX19
Swissprot Id:
O60806
Protein Accession #:
NP_005140
Nucleotide Accession #:
NM_005149
Alias Symbols:
TPIT, TBS19, dJ747L4.1
Replacement Item:
This antibody may replace item sc-134060 from Santa Cruz Biotechnology.
Description of Target:
TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
Protein Size (# AA):
448
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBX19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBX19.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TBX19 (ARP32363_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NR5A1;
Blocking Peptide:
For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
Datasheets/Manuals:
Printable datasheet for anti-TBX19 (ARP32363_T100) antibody
Target Reference:
Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532

Tell us what you think about this item!

Write A Review
    Please, wait...