- Gene Symbol:
- TBX19
- NCBI Gene Id:
- 9095
- Official Gene Full Name:
- T-box 19
- Protein Name:
- T-box transcription factor TBX19
- Swissprot Id:
- O60806
- Protein Accession #:
- NP_005140
- Nucleotide Accession #:
- NM_005149
- Alias Symbols:
- TPIT, TBS19, dJ747L4.1
- Replacement Item:
- This antibody may replace item sc-134060 from Santa Cruz Biotechnology.
- Description of Target:
- TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
- Protein Size (# AA):
- 448
- Molecular Weight:
- 48kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express TBX19.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express TBX19.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
- Complete computational species homology data:
- Anti-TBX19 (ARP32363_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- NR5A1;
- Blocking Peptide:
- For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
- Datasheets/Manuals:
- Printable datasheet for anti-TBX19 (ARP32363_T100) antibody
- Target Reference:
- Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
