TBX19 Antibody - N-terminal region (ARP32363_T100)

Catalog#: ARP32363_T100

• Size: 100 ul

• Gene Symbol: TBX19
• Official Gene Full Name: T-box 19
• NCBI Gene Id: 9095
• Protein Name: T-box transcription factor TBX19
• Swissprot Id: O60806
• Protein Accession #: NP_005140
• Nucleotide Accession #: NM_005149
• Alias Symbols: TPIT, TBS19, dJ747L4.1
• Replacement Item: This antibody may replace item sc-134060 from Santa Cruz Biotechnology.
• Description of Target: TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
• Protein Size (# AA): 448
• Molecular Weight: 48kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Protein A purified
• Application: IHC, WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express TBX19.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: NR5A1;
• Blocking Peptide: For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352)
• Target Reference: Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: TBX19 antibody tested with Human Jurkat Cells (ARP32363_T100)

Product Protocols: TBX19 antibody tested by IHC with human kidney (ARP32363)

Product Protocols: TBX19 antibody tested by IHC with human liver (ARP32363)