- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-TBP (P100971_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBP |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-TBP (P100971_T100) antibody is Catalog # AAP31331 (Previous Catalog # AAPP02082) |
Reference | Reid,S.J., et al., (2004) Brain Res. Mol. Brain Res. 125 (1-2), 120-128 |
Gene Symbol | TBP |
---|---|
Gene Full Name | TATA box binding protein |
Alias Symbols | HDL4, GTF2D, SCA17, TFIID, GTF2D1 |
NCBI Gene Id | 6908 |
Protein Name | TATA-box-binding protein |
Description of Target | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. |
Uniprot ID | P20226 |
Protein Accession # | NP_003185 |
Nucleotide Accession # | NM_003194 |
Protein Size (# AA) | 339 |
Molecular Weight | 38kDa |
Protein Interactions | DR1; SSX2IP; GOLGA2; MEF2A; TAF8; GNG12; GNB2; UBC; UBE2I; TAF10; TAF5; HNF4A; E2F1; PAX5; TAF1A; TCEA1; RUVBL2; Abt1; GTF2A2; ICE2; tat; MED26; TBP; TAF6; TAF4; TAF1; SP1; TP53; SNAPC2; SNAPC1; MUC1; Taf1c; Taf1b; GTF2B; HCVgp1; AHR; TAF9B; BTAF1; TAF13; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TBP Antibody - middle region (P100971_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "TBP Antibody - middle region (P100971_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TBP Antibody - middle region (P100971_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TBP Antibody - middle region (P100971_T100)"?
This target may also be called "HDL4, GTF2D, SCA17, TFIID, GTF2D1" in publications.
-
What is the shipping cost for "TBP Antibody - middle region (P100971_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TBP Antibody - middle region (P100971_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TBP Antibody - middle region (P100971_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "38kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TBP Antibody - middle region (P100971_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TBP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TBP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TBP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TBP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TBP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TBP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.