TBL2 Antibody - N-terminal region : HRP (ARP53685_P050-HRP)

Catalog No: ARP53685_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TBL2 (ARP53685_P050-HRP) antibody is Catalog # AAP53685 (Previous Catalog # AAPP30527)

Target Info

• Reference: Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197
• Gene Symbol: TBL2
• Gene Full Name: Transducin (beta)-like 2
• Alias Symbols: WBSCR13, WS-betaTRP
• NCBI Gene Id: 26608
• Protein Name: Transducin beta-like protein 2
• Description of Target: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
• Uniprot ID: Q9Y4P3
• Protein Accession #: NP_036585
• Nucleotide Accession #: NM_012453
• Protein Size (# AA): 447
• Molecular Weight: 49kDa
• Protein Interactions: UBC; SUMO1; SUZ12; RNF2; ESR1; MRPL53; SARNP; SUGP1; CDV3; RBM27; SF3B4; SOD2; SCP2; RPS19; NDUFA7; NDUFA2; SERPINH1; UBD; GRK5; COPS5; CUL3; PDPK1; USP44;