Size:100 ug
$299.00
In Stock
SKU
OAAF07892
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07892-FITC Conjugated

OAAF07892-HRP Conjugated

OAAF07892-Biotin Conjugated

TBK1 Antibody (OAAF07892)

Catalog#: OAAF07892
Domestic: within 1 week delivery | International: 1 week
More Information
Predicted Species Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Application IHC
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-398366 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human TBK1.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Peptide Sequence Synthetic peptide located within the following region: PGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYER
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07892
Specificity TBK1 Antibody detects endogenous levels of TBK1.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene Symbol TBK1
Alias Symbols kinase TBK1, NF-KB-activating kinase NAK, TANK binding kinase TBK1
NCBI Gene Id 29110
Swissprot Id Q9UHD2
Molecular Weight 83 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TBK1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TBK1.
  1. What is the species homology for "TBK1 Antibody (OAAF07892)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".

  2. How long will it take to receive "TBK1 Antibody (OAAF07892)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "TBK1 Antibody (OAAF07892)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TBK1 Antibody (OAAF07892)"?

    This target may also be called "kinase TBK1, NF-KB-activating kinase NAK, TANK binding kinase TBK1" in publications.

  5. What is the shipping cost for "TBK1 Antibody (OAAF07892)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TBK1 Antibody (OAAF07892)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TBK1 Antibody (OAAF07892)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TBK1 Antibody (OAAF07892)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TBK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TBK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TBK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TBK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TBK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TBK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TBK1 Antibody (OAAF07892)
Your Rating
We found other products you might like!