Search Antibody, Protein, and ELISA Kit Solutions

TBK1 Antibody (OAAF07892)

100 ug
$379.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF07892-FITC Conjugated

OAAF07892-HRP Conjugated

OAAF07892-Biotin Conjugated

Predicted Species Reactivity:
Human, Mouse
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, ELISA
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Gene Symbol:
TBK1
NCBI Gene Id:
29110
Swissprot Id:
Q9UHD2
Alias Symbols:
kinase TBK1, NF-KB-activating kinase NAK, TANK binding kinase TBK1
Replacement Item:
This antibody may replace item sc-398366 from Santa Cruz Biotechnology.
Molecular Weight:
83 kDa
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBK1.
Immunogen:
The antiserum was produced against synthesized peptide derived from human TBK1.
Peptide Sequence:
Synthetic peptide located within the following region: PGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYER
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07892
Specificity:
TBK1 Antibody detects endogenous levels of TBK1.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:

IHC: 1:50~1:100
ELISA: 1:10000

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...