Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP54921_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54921_P050-FITC Conjugated

ARP54921_P050-HRP Conjugated

ARP54921_P050-Biotin Conjugated

TBK1 Antibody - N-terminal region (ARP54921_P050)

Catalog#: ARP54921_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-398366 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBK1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-TBK1 (ARP54921_P050)
Peptide Sequence Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TBK1 (ARP54921_P050) antibody is Catalog # AAP54921 (Previous Catalog # AAPP31876)
Datasheets/Manuals Printable datasheet for anti-TBK1 (ARP54921_P050) antibody
Target Reference Morton,S., (2008) FEBS Lett. 582 (6), 997-1002
Gene Symbol TBK1
Official Gene Full Name TANK-binding kinase 1
Alias Symbols FLJ11330, NAK, T2K
NCBI Gene Id 29110
Protein Name Serine/threonine-protein kinase TBK1
Description of Target The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK. The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9UHD2
Protein Accession # NP_037386
Nucleotide Accession # NM_013254
Protein Size (# AA) 729
Molecular Weight 84kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TBK1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TBK1.
Protein Interactions UBC; Trim11; AZI2; TBK1; TANK; TBKBP1; EGFR; TMEM173; TRAF3; EXOC2; MIB1; LATS2; ANKRD28; DDX58; SYK; TRAF3IP2; TOMM70A; STX11; PROS1; IRF3; HSP90AA1; XIAP; RNF11; YWHAE; APP; NFKBIA; IKBKG; TRAF2; MAVS; OPTN; SRC; RELA; TICAM1; MBP; IRF7; IKBKE; HERC2; T
Write Your Own Review
You're reviewing:TBK1 Antibody - N-terminal region (ARP54921_P050)
Your Rating