Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

TBK1 Antibody - N-terminal region (ARP54921_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54921_P050-FITC Conjugated

ARP54921_P050-HRP Conjugated

ARP54921_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
TANK-binding kinase 1
NCBI Gene Id:
Protein Name:
Serine/threonine-protein kinase TBK1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ11330, NAK, T2K
Replacement Item:
This antibody may replace item sc-398366 from Santa Cruz Biotechnology.
Description of Target:
The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK. The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBK1.
The immunogen is a synthetic peptide directed towards the N terminal region of human TBK1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-TBK1 (ARP54921_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TBK1 (ARP54921_P050) antibody is Catalog # AAP54921 (Previous Catalog # AAPP31876)
Printable datasheet for anti-TBK1 (ARP54921_P050) antibody
Target Reference:
Morton,S., (2008) FEBS Lett. 582 (6), 997-1002

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...