Search Antibody, Protein, and ELISA Kit Solutions

TBK1 Antibody - middle region (ARP54922_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54922_P050-FITC Conjugated

ARP54922_P050-HRP Conjugated

ARP54922_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
TANK-binding kinase 1
NCBI Gene Id:
Protein Name:
Serine/threonine-protein kinase TBK1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ11330, NAK, T2K
Replacement Item:
This antibody may replace item sc-398366 from Santa Cruz Biotechnology.
Description of Target:
The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitinat
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBK1.
The immunogen is a synthetic peptide directed towards the middle region of human TBK1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-TBK1 (ARP54922_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TBK1 (ARP54922_P050) antibody is Catalog # AAP54922 (Previous Catalog # AAPP31877)
Printable datasheet for anti-TBK1 (ARP54922_P050) antibody
Target Reference:
Morton,S., (2008) FEBS Lett. 582 (6), 997-1002

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...