Search Antibody, Protein, and ELISA Kit Solutions

TAZ Antibody - middle region (ARP74277_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74277_P050-FITC Conjugated

ARP74277_P050-HRP Conjugated

ARP74277_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TAZ
NCBI Gene Id:
6901
Swissprot Id:
Q16635
Alias Symbols:
TAZ, EFE2, G4.5,
Description of Target:
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Protein Size (# AA):
292
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAZ.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human TAZ
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LATS2; CSNK1E; CHGB; LATS1; BTRC; STK3; UBC; GSK3B;
Blocking Peptide:
For anti-TAZ (ARP74277_P050) antibody is Catalog # AAP74277
Datasheets/Manuals:
Printable datasheet for anti-TAZ (ARP74277_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...