TAS2R14 Antibody - C-terminal region (ARP82859_P050)

Catalog No: ARP82859_P050

Host: Rabbit
Target Name: TAS2R14
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAS2R14
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TAS2R14 (ARP82859_P050) antibody is Catalog # AAP82859

Target Info

• Gene Symbol: TAS2R14
• Gene Full Name: taste 2 receptor member 14
• Alias Symbols: TRB1, T2R14
• NCBI Gene Id: 50840
• Protein Name: taste receptor type 2 member 14
• Description of Target: This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13.
• Uniprot ID: Q9NYV8
• Protein Accession #: NP_076411.1
• Nucleotide Accession #: NM_023922.1
• Protein Size (# AA): 317
• Molecular Weight: 34 kDa