Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TARDBP antibody - N-terminal region (ARP38941_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP38941_T100-FITC Conjugated

ARP38941_T100-HRP Conjugated

ARP38941_T100-Biotin Conjugated

Gene Symbol:
TARDBP
NCBI Gene Id:
23435
Official Gene Full Name:
TAR DNA binding protein
Protein Name:
TAR DNA-binding protein 43
Swissprot Id:
Q13148
Protein Accession #:
NP_031401
Nucleotide Accession #:
NM_007375
Alias Symbols:
ALS10, TDP-43
Replacement Item:
This antibody may replace item sc-100871 from Santa Cruz Biotechnology.
Description of Target:
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Protein Size (# AA):
414
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TARDBP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TARDBP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-TARDBP (ARP38941_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZFAND2B; TARDBP; UBC; SUMO2; STAU1; SUMO3; RNF4; USP8; RBM45; RNF2; LSM6; UBE2E3; GNB2L1; MED6; RPA1; WWOX; RPA3; RPA2; PARK2; EED; BMI1; RBM39; BAG2; RPL23; DDX21; PRPF3; USP10; SART1; RPL14; H1FX; FUBP3; PABPC4; EIF4G3; EIF3I; EIF3H; EIF3C; EIF3B; EIF3A
Blocking Peptide:
For anti-TARDBP (ARP38941_T100) antibody is Catalog # AAP38941 (Previous Catalog # AAPY00750)
Datasheets/Manuals:
Printable datasheet for anti-TARDBP (ARP38941_T100) antibody
Sample Type Confirmation:

TARDBP is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Buratti,E., (2005) J. Biol. Chem. 280 (45), 37572-37584
Publications:

Estes, P. S. et al. Wild-type and A315T mutant TDP-43 exert differential neurotoxicity in a Drosophila model of ALS. Hum. Mol. Genet. 20, 2308-21 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 21441568

Tell us what you think about this item!

Write A Review
    Please, wait...