SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45437_P050
Price: $0.00
SKU
ARP45437_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAPBP (ARP45437_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Human: 100%; Pig: 86%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAPBP (ARP45437_P050) antibody is Catalog # AAP45437 (Previous Catalog # AAPP26506)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceFacoetti,A., (2005) Clin. Cancer Res. 11 (23), 8304-8311
Gene SymbolTAPBP
Gene Full NameTAP binding protein (tapasin)
Alias SymbolsTPN, TAPA, TPSN, NGS17
NCBI Gene Id6892
Protein NameTapasin
Description of TargetTAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
Uniprot IDO15533
Protein Accession #NP_003181
Nucleotide Accession #NM_003190
Protein Size (# AA)448
Molecular Weight46kDa
Protein InteractionsUBC; PDIA3; Tap2; ELAVL1; US3; TAP1; B2M; COPG1; COPG2; COPB1; HLA-C; HLA-A; CALR;
  1. What is the species homology for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Pig, Sheep".

  2. How long will it take to receive "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAPBP Antibody - C-terminal region (ARP45437_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    This target may also be called "TPN, TAPA, TPSN, NGS17" in publications.

  5. What is the shipping cost for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAPBP Antibody - C-terminal region (ARP45437_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAPBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAPBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAPBP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAPBP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAPBP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAPBP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAPBP Antibody - C-terminal region (ARP45437_P050)
Your Rating
We found other products you might like!