Search Antibody, Protein, and ELISA Kit Solutions

TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73724_P050 Unconjugated

ARP73724_P050-HRP Conjugated

ARP73724_P050-Biotin Conjugated

Gene Symbol:
TAOK1
NCBI Gene Id:
57551
Swissprot Id:
Q7L7X3-2
Alias Symbols:
TAOK1, KIAA1361, MAP3K16, MARKK,
Replacement Item:
This antibody may replace item sc-130857 from Santa Cruz Biotechnology.
Description of Target:
TAOK1 is a Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. TAOK1 phosphorylates MAP2K3, MAP2K6 and MARK2. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. It is involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, It is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. TAOK1 acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. TAOK1 also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
Protein Size (# AA):
398
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAOK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAOK1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
STK26; STK25; UBC; MAP3K7; SRBD1; GEMIN7; C8orf33; WT1; DYNC1I1; CSNK1E; STK4; MARK1; MAP2K3;
Blocking Peptide:
For anti-TAOK1 (ARP73724_P050-FITC) antibody is Catalog # AAP73724
Datasheets/Manuals:
Printable datasheet for anti-TAOK1 (ARP73724_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...