Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73724_P050 Unconjugated

ARP73724_P050-HRP Conjugated

ARP73724_P050-Biotin Conjugated

TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)

Catalog#: ARP73724_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-130857 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ
Concentration 0.5 mg/ml
Blocking Peptide For anti-TAOK1 (ARP73724_P050-FITC) antibody is Catalog # AAP73724
Datasheets/Manuals Printable datasheet for anti-TAOK1 (ARP73724_P050-FITC) antibody
Gene Symbol TAOK1
Alias Symbols TAOK1, KIAA1361, MAP3K16, MARKK,
NCBI Gene Id 57551
Description of Target TAOK1 is a Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. TAOK1 phosphorylates MAP2K3, MAP2K6 and MARK2. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. It is involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, It is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. TAOK1 acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. TAOK1 also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
Swissprot Id Q7L7X3-2
Protein Size (# AA) 398
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TAOK1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TAOK1.
Protein Interactions STK26; STK25; UBC; MAP3K7; SRBD1; GEMIN7; C8orf33; WT1; DYNC1I1; CSNK1E; STK4; MARK1; MAP2K3;
  1. What is the species homology for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    This target may also be called "TAOK1, KIAA1361, MAP3K16, MARKK, " in publications.

  5. What is the shipping cost for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TAOK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAOK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAOK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAOK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAOK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAOK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAOK1 Antibody - middle region : FITC (ARP73724_P050-FITC)
Your Rating
We found other products you might like!