Search Antibody, Protein, and ELISA Kit Solutions

TAL1 antibody - N-terminal region (ARP31428_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31428_P050-FITC Conjugated

ARP31428_P050-HRP Conjugated

ARP31428_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
T-cell acute lymphocytic leukemia 1
Protein Name:
T-cell acute lymphocytic leukemia protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
SCL, TCL5, tal-1, bHLHa17
Replacement Item:
This antibody may replace item sc-12982 from Santa Cruz Biotechnology.
Description of Target:
TAL1 is implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. It also serves as a positive regulator of erythroid differentiation
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human TAL1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Complete computational species homology data:
Anti-TAL1 (ARP31428_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TAL1 (ARP31428_P050) antibody is Catalog # AAP31428 (Previous Catalog # AAPP03106)
Printable datasheet for anti-TAL1 (ARP31428_P050) antibody
Target Reference:
Zhang,M. (2008) J. Biol. Chem. 283 (11), 6717-6727

Hosur, V. et al. Retrotransposon insertion in the T-cell acute lymphocytic leukemia 1 (Tal1) gene is associated with severe renal disease and patchy alopecia in Hairpatches (Hpt) mice. PLoS One 8, e53426 (2013). WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 23301070

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...