Search Antibody, Protein, and ELISA Kit Solutions

TAL1 Antibody - N-terminal region (ARP31428_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP31428_P050-FITC Conjugated

ARP31428_P050-HRP Conjugated

ARP31428_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-12982 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TAL1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Complete computational species homology data:
Anti-TAL1 (ARP31428_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAL1 (ARP31428_P050) antibody is Catalog # AAP31428 (Previous Catalog # AAPP03106)
Datasheets/Manuals:
Printable datasheet for anti-TAL1 (ARP31428_P050) antibody
Target Reference:
Zhang,M. (2008) J. Biol. Chem. 283 (11), 6717-6727
Publications:

Hosur, V. et al. Retrotransposon insertion in the T-cell acute lymphocytic leukemia 1 (Tal1) gene is associated with severe renal disease and patchy alopecia in Hairpatches (Hpt) mice. PLoS One 8, e53426 (2013). WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 23301070

Gene Symbol:
TAL1
Official Gene Full Name:
T-cell acute lymphocytic leukemia 1
Alias Symbols:
SCL, TCL5, tal-1, bHLHa17
NCBI Gene Id:
6886
Protein Name:
T-cell acute lymphocytic leukemia protein 1
Description of Target:
TAL1 is implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. It also serves as a positive regulator of erythroid differentiation
Swissprot Id:
P17542
Protein Accession #:
NP_003180
Nucleotide Accession #:
NM_003189
Protein Size (# AA):
331
Molecular Weight:
34kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAL1.
Protein Interactions:
ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...