Search Antibody, Protein, and ELISA Kit Solutions

TAGLN2 Antibody - middle region (ARP81884_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TAGLN2
Official Gene Full Name:
transgelin 2
NCBI Gene Id:
8407
Protein Name:
transgelin-2
Swissprot Id:
P37802-2
Protein Accession #:
NP_001264152.1
Nucleotide Accession #:
NM_001277223.1
Alias Symbols:
HA1756
Description of Target:
The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
220
Molecular Weight:
24 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAGLN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAGLN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle terminal region of human TAGLN2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAGLN2 (ARP81884_P050) antibody is Catalog # AAP81884
Datasheets/Manuals:
Printable datasheet for anti-TAGLN2 (ARP81884_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...