Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP81884_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

TAGLN2 Antibody - middle region (ARP81884_P050)

Catalog#: ARP81884_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle terminal region of human TAGLN2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: NWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-TAGLN2 (ARP81884_P050) antibody is Catalog # AAP81884
Datasheets/ManualsPrintable datasheet for anti-TAGLN2 (ARP81884_P050) antibody
Gene SymbolTAGLN2
Official Gene Full Nametransgelin 2
Alias SymbolsHA1756
NCBI Gene Id8407
Protein Nametransgelin-2
Description of TargetThe protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot IdP37802-2
Protein Accession #NP_001264152.1
Nucleotide Accession #NM_001277223.1
Protein Size (# AA)220
Molecular Weight24 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TAGLN2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TAGLN2.
Write Your Own Review
You're reviewing:TAGLN2 Antibody - middle region (ARP81884_P050)
Your Rating
Aviva Pathways
Aviva Travel Grant
Aviva Live Chat
Aviva HIS tag Deal