Search Antibody, Protein, and ELISA Kit Solutions

TAF9 Antibody - N-terminal region (ARP34551_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34551_P050-FITC Conjugated

ARP34551_P050-HRP Conjugated

ARP34551_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-110799 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF9
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 90%
Complete computational species homology data:
Anti-TAF9 (ARP34551_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAF9 (ARP34551_P050) antibody is Catalog # AAP34551 (Previous Catalog # AAPP05733)
Datasheets/Manuals:
Printable datasheet for anti-TAF9 (ARP34551_P050) antibody
Target Reference:
Evans,S.C., et al., (1999) 57 (1), 182-183
Gene Symbol:
TAF9
Official Gene Full Name:
TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa
Alias Symbols:
AK6, CIP, CINAP, TAF2G, AD-004, hCINAP, CGI-137, TAFII31, TAFII32, MGC:1603, MGC:3647, MGC:5067, TAFIID32
NCBI Gene Id:
6880
Protein Name:
Adenylate kinase isoenzyme 6
Description of Target:
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16.
Swissprot Id:
Q9Y3D8
Protein Accession #:
NP_001015891
Nucleotide Accession #:
NM_001015891
Protein Size (# AA):
169
Molecular Weight:
19kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAF9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAF9.
Protein Interactions:
TAF6L; DRAP1; LAMTOR5; NDRG1; RPS14; KPNA1; UBC; TBCA; NCOA2; FEZ1; RPS24; ANK2; HNF4A; GALNT6; MED26; KAT2B; HIST3H3; FBLN1; COIL; AHR; TAF1L; TAF9B; TBP; TAF13; TAF10; TAF7; TAF6; TAF5; TAF4; TAF2; FKBP4; FBL; DHX8; APP; CIITA; RNF138; KPNA6; UBA1; ALL1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...