Taf7l Antibody - C-terminal region (ARP37401_P050)

Catalog No: ARP37401_P050

Host: Rabbit
Target Name: Taf7l
Sample Type: Mouse Muscle lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse, Rat, Cow, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Taf7l
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 82%; Mouse: 100%; Pig: 75%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Taf7l (ARP37401_P050) antibody is Catalog # AAP37401

Target Info

• Gene Symbol: Taf7l
• Gene Full Name: TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
• Alias Symbols: Taf2, Taf2q, 4933438I11Rik
• NCBI Gene Id: 74469
• Protein Name: Transcription initiation factor TFIID subunit 7-like
• Description of Target: Taf7l probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in spermatogenesis.
• Uniprot ID: Q9D3R9
• Protein Accession #: NP_083234
• Nucleotide Accession #: NM_028958
• Protein Size (# AA): 471
• Molecular Weight: 51kDa
• Protein Interactions: Tbp;