Loading...
Catalog No: P100968_P050
Price: $0.00
SKU
P100968_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAF7 (P100968_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAF7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF7 (P100968_P050) antibody is Catalog # AAP31329 (Previous Catalog # AAPP02079)
Subunit7
ReferenceGegonne,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5367-5372
Description
Gene SymbolTAF7
Gene Full NameTAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Alias SymbolsTAF2F, TAFII55
NCBI Gene Id6879
Protein NameTranscription initiation factor TFIID subunit 7
Description of TargetThe intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ15545
Protein Accession #NP_005633
Nucleotide Accession #NM_005642
Protein Size (# AA)349
Molecular Weight40kDa
Protein InteractionsUBC; FAU; RBM6; MED26; HIST3H3; LEO1; TAF9B; TRRAP; TAF10; TAF9; TAF6; TAF5; TAF4; TAF1; TBP; ERCC1; MAP1LC3B; CPSF1; CDK9; CDK7; CCNT1; TAF3; TAF8; SETD7; VDR; THRA; ZSCAN1; TRIM22; IKBKG; GATA1; TAF12; TAF11; TAF15; TAF7; TAF2; TRIM24; AHR; HSF1; ERCC3;
  1. What is the species homology for "TAF7 Antibody - middle region (P100968_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig".

  2. How long will it take to receive "TAF7 Antibody - middle region (P100968_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF7 Antibody - middle region (P100968_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF7 Antibody - middle region (P100968_P050)"?

    This target may also be called "TAF2F, TAFII55" in publications.

  5. What is the shipping cost for "TAF7 Antibody - middle region (P100968_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF7 Antibody - middle region (P100968_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF7 Antibody - middle region (P100968_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF7 Antibody - middle region (P100968_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF7 Antibody - middle region (P100968_P050)
Your Rating
We found other products you might like!