Search Antibody, Protein, and ELISA Kit Solutions

TAF6 Antibody - N-terminal region : FITC (ARP34693_T100-FITC)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34693_T100 Unconjugated

ARP34693_T100-HRP Conjugated

ARP34693_T100-Biotin Conjugated

Gene Symbol:
TAF6
Official Gene Full Name:
TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
NCBI Gene Id:
6878
Protein Name:
Transcription initiation factor TFIID subunit 6
Swissprot Id:
A4D2B3
Protein Accession #:
NP_620834
Nucleotide Accession #:
NM_139122
Alias Symbols:
DKFZp781E21155, MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85, TAFII-70, TAFII-80, TAF(II)70, TAF(II)80
Replacement Item:
This antibody may replace item sc-104686 from Santa Cruz Biotechnology.
Description of Target:
TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6 is one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1,the largest subunit of TFIID. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.
Protein Size (# AA):
667
Molecular Weight:
71kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAF6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 86%
Complete computational species homology data:
Anti-TAF6 (ARP34693_T100)
Peptide Sequence:
Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SOX5; HNF4A; MED26; TRRAP; HIST3H3; UBC; TBP; AHR; APP; TAF1L; TAF3; TAF9B; TAF10; TAF9; TAF7; TAF5; TAF4; TAF2; TAF1; KMT2A; USF1; ERCC1; TAF8; KAT2A; SETD7; NR1D2; NCOR1; NFYC; NFYB; NFYA; MBD3; SIN3A; ALL1; SAP30; SMARCC2; SMARCC1; SMARCB1; SMARCA2; RB
Blocking Peptide:
For anti-TAF6 (ARP34693_T100-FITC) antibody is Catalog # AAP34693 (Previous Catalog # AAPP23644)
Datasheets/Manuals:
Printable datasheet for anti-TAF6 (ARP34693_T100-FITC) antibody
Subunit:
6
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...