- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)
Datasheets/Manuals | Printable datasheet for anti-TAF6 (ARP34693_T100-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TAF6 (ARP34693_T100-Biotin) antibody is Catalog # AAP34693 (Previous Catalog # AAPP23644) |
Subunit | 6 |
Reference | Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Gene Symbol | TAF6 |
---|---|
Gene Full Name | TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa |
Alias Symbols | ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF(II)70, TAF(II)80 |
NCBI Gene Id | 6878 |
Protein Name | Transcription initiation factor TFIID subunit 6 |
Description of Target | TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6 is one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1,the largest subunit of TFIID. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis. |
Uniprot ID | A4D2B3 |
Protein Accession # | NP_620834 |
Nucleotide Accession # | NM_139122 |
Protein Size (# AA) | 667 |
Molecular Weight | 71kDa |
Protein Interactions | SOX5; HNF4A; MED26; TRRAP; HIST3H3; UBC; TBP; AHR; APP; TAF1L; TAF3; TAF9B; TAF10; TAF9; TAF7; TAF5; TAF4; TAF2; TAF1; KMT2A; USF1; ERCC1; TAF8; KAT2A; SETD7; NR1D2; NCOR1; NFYC; NFYB; NFYA; MBD3; SIN3A; ALL1; SAP30; SMARCC2; SMARCC1; SMARCB1; SMARCA2; RB |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish".
-
How long will it take to receive "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
This target may also be called "ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF(II)70, TAF(II)80" in publications.
-
What is the shipping cost for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "71kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TAF6 Antibody - N-terminal region : Biotin (ARP34693_T100-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TAF6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TAF6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TAF6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TAF6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TAF6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TAF6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.