Search Antibody, Protein, and ELISA Kit Solutions

TAF6 Antibody - C-terminal region (ARP38653_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38653_P050-FITC Conjugated

ARP38653_P050-HRP Conjugated

ARP38653_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-104686 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF6
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-TAF6 (ARP38653_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAF6 (ARP38653_P050) antibody is Catalog # AAP38653 (Previous Catalog # AAPP20843)
Datasheets/Manuals:
Printable datasheet for anti-TAF6 (ARP38653_P050) antibody
Subunit:
6
Target Reference:
Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292
Gene Symbol:
TAF6
Official Gene Full Name:
TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
Alias Symbols:
DKFZp781E21155, MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85, TAFII-70, TAFII-80, TAF(II)70, TAF(II)80
NCBI Gene Id:
6878
Protein Name:
Transcription initiation factor TFIID subunit 6
Description of Target:
TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6 is one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1,the largest subunit of TFIID. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.
Swissprot Id:
P49848
Protein Accession #:
NP_005632
Nucleotide Accession #:
NM_005641
Protein Size (# AA):
677
Molecular Weight:
73kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAF6.
Protein Interactions:
SOX5; HNF4A; MED26; TRRAP; HIST3H3; UBC; TBP; AHR; APP; TAF1L; TAF3; TAF9B; TAF10; TAF9; TAF7; TAF5; TAF4; TAF2; TAF1; KMT2A; USF1; ERCC1; TAF8; KAT2A; SETD7; NR1D2; NCOR1; NFYC; NFYB; NFYA; MBD3; SIN3A; ALL1; SAP30; SMARCC2; SMARCC1; SMARCB1; SMARCA2; RB

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...