SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31877_P050
Price: $0.00
SKU
ARP31877_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAF5L (ARP31877_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TAF5L
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: FVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDI
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF5L (ARP31877_P050) antibody is Catalog # AAP31877 (Previous Catalog # AAPP23935)
Subunit5L
Gene SymbolTAF5L
Gene Full NameTAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Alias SymbolsPAF65B
NCBI Gene Id27097
Protein NameTAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
Description of TargetInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF5L encodes a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF5. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
Uniprot IDO75529-2
Protein Accession #NP_001020418
Nucleotide Accession #NM_001025247
Protein Size (# AA)325
Molecular Weight37kDa
Protein InteractionsHECW2; UBC; KAT2B; LSM11; TADA3; TAF10; ELAVL1; TSC22D1; TTR; H2AFX; CDKN1A; ANXA7; KAT2A; TP53; ATXN7; CEBPE; USP22; ATXN7L3; SUPT3H; TAF9; MYC;
  1. What is the species homology for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF5L Antibody - N-terminal region (ARP31877_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    This target may also be called "PAF65B" in publications.

  5. What is the shipping cost for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF5L Antibody - N-terminal region (ARP31877_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF5L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF5L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF5L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF5L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF5L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF5L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF5L Antibody - N-terminal region (ARP31877_P050)
Your Rating
We found other products you might like!